This is an example showing example shows a sample report table, trial design, and results data of Study #123 dataset for study 123 for the determination of the in vitro genotoxicity potential of 10 tobacco products in using the in vitro Micronucleus Assay
...
micronucleus assay.
Expand |
---|
title | Sample Report Table for Study 123 |
---|
|
Image Added |
Dataset wrap |
---|
Rowcaps |
---|
Rows 1-2: | Show 2 records for TSPARMCD = "GLPTYP", using TSSEQ to indicate multiple records, since both GLP types apply for this example study. | Row 3: | Shows that this study was conducted as a GLP study. | Rows 4-5: | Show the study start date and study title. | Rows 6-7: | Show the version of SEND Implementation Guide and version of Controlled Terminology used in this study. | Row 8: | Shows the applicant's organization. | Row 9: | Shows that the applicant's study reference ID is not applicable. | Rows 10-13: | Show that TSGRPID has been used to link records (name, location, country) related to the test facility (TSGRPID = 1). The study director is associated with the test facility. | Rows 14-16: | Show that TSGRPID (TSGRPID=2) has been used to link the information on the testing guideline followed on this study (TSTGDNAM, TSTGDORG, TSTGDVER). | | Shows the study type for this study. | | Shows that this study includes a Mammalian Cell Micronucleus Assay. | Rows 19-20: | Show that the species is human and the cell line is TK6 lymphoblastoid in this study. |
|
Dataset2 |
---|
Row | STUDYID | DOMAIN | TSSEQ | TSGRPID | TSPARMCD | TSPARM | TSVAL | TSVALNF |
---|
1 | 123 |
| ts.xpt | 1 | TS | 1 | SSTYP | Study Type | REPEAT DOSE TOXICITY | 2 | TS | 1 | SPECIES | Species | RAT | 3 | TS | 1 | STRAIN | Strain/Substrain | FISCHER 344 | 4 | TS | 1 | SPLRNAM | Test Subject Supplier | HARLAN | 5 | TS | 1 | SDESIGN | Study Design | CROSSOVER | 6 | TS | 1 | ROUTE | Route of Administration | ORAL | 7 | TS | 1 |
| GLPTYP | Good Laboratory Practice Type | FDA |
| 2 | 81 | EXPSTDTC | Experimental Start Date | 2008-01-01 |
| GLPTYP | Good Laboratory Practice Type | OECD |
| 3 | 123 | 9EXPENDTC | Experimental End Date | 2008-03-07 | 10 | TS | 1 | TRMSAC | Time to Terminal Sacrifice | P42D | 11 | TS | 1 |
| STSTDTC | Study Start Date | 2007123012 | TS | 1 | DOSDUR | Dosing Duration | P42D | 13 | Example a Crossover study in the Rat with 3 dose levels and 3 dosing periodsthe in vitro genotoxicity potential using the in vitro Neutral Red Uptake assay |
| 6 | 123 | 14 | TS | 1 |
| SNDIGVER | SEND Implementation Guide Version | SEND TOBACCO IMPLEMENTATION GUIDE VERSION | 3215123 | TS | 1 |
| SNDCTVER | SEND Controlled Terminology Version | SEND Terminology 2021- | 032616TS | 1 | STCAT | Study Category | TOX | 17 | SSPONSORSponsor Organization Sponsor 18SPREFIDSponsor's Study Reference ID |
| NOT APPLICABLE | 10 | 19123 | TS | 1 | 1 | TSTFNAM | Test Facility Name | Example | Tox 20123 | TS | 1 | 1 | TSTFLOC | Test Facility Location | 10 Somewhere Street, Montgomery, AL 10000 |
| 12 | 21123 | TS | 1 | 1 | TFCNTRY | Test Facility Country | USA |
| 13 | 22AGETXT | Age Text | 6-8 | 23STDIR | Study Director | Dr. R. Smith |
| 14 | 123 | TS | 1 |
AGEU | Age Unit | WEEKS | 24 | 2 | TSTGDNAM | Testing Guideline Name | GUIDELINE FOR THE TESTING OF CHEMICALS No. 487 |
| 15 | 123 | TS | 1 | 2 | 1STDIR | Study Director | Dr. R. Smith | Testing Guideline Organization | OECD |
| 16 | 123 | 25TRT | Investigational Therapy or Treatment | Drug A | | 2 | TSTGDVER | Testing Guideline Version | 29-July-2016 |
| 17 | 123 | 262TRTV | Treatment Vehicle | Saline | 27Study Type | GENOTOXICITY IN VITRO |
| 18 | 123 | TS | 1 |
2 | TRTVDESC | Treatment Vehicle Structured Description | 100.46 %(w/v) ISOTONIC SODIUM CHLORIDE SOLUTION {UNII VR5Y7PDT5W} |
| GNTXAID | Genetic Toxicology Assay Identifier | MNvit |
| 19 | 123 | 28GLPFLGLP FlagY29 |
|
This example Trial Sets dataset shows information about the test conditions for set A1 and A2 in this example study. Sets A1 and A2 can be seen in the first and second rows respectively of the sample report Table 1 (above). For brevity, the TX dataset and the findings (GT) dataset do not show information for any other sets. Fully formed datasets for this example study would include information about the test conditions and findings for all sets.
Dataset wrap |
---|
|
Rowcaps |
---|
Rows 1-23: | Show trial set parameters and values that comprise the test conditions for trial set A1. Set A1 is the data for the negative control (concentration 0) with short-term exposure and metabolic activation S9. The applicant has chosen to given a long name (SET) equal to "ST+S9_C0". Set A1 is associated with the first row in the sample report table for study 123. | Rows 24-46: | Show trial set parameters and values that comprise the test conditions for trial set A2. Set A2 is the data for the short-term exposure with metabolic activation S9 at a concentration of 1250 ug/ml. The applicant has chosen to give the set a long name (SET) equal to "ST+S9_C1250". Set A2 is associated with the second row in the sample report table for study 123. |
|
Dataset2 |
---|
TRTCAS | Primary Treatment CAS Registry Number | TEMPORARILY UNAVAILABLE | Expand |
---|
title | Full SEND ts.xpt FOR REFERENCE |
---|
TSSEQTSGRPIDTSPARMCDTSPARMTSVALTSVALNFTSSSTYP | Study Type | REPEAT DOSE TOXICITY | 2 | TS | 1 | SPECIES | Species | RAT | 3 | TS | 1 | STRAIN | Strain/Substrain | FISCHER 344 | 4 | TS | 1 | SPLRNAM | Test Subject Supplier | HARLAN | 5 | TS | 1 | SDESIGN | Study Design | CROSSOVER | 6 | TS | 1 | ROUTE | Route of Administration | ORAL | 7 | TS | 1 | GLPTYP | Good Laboratory Practice Type | FDA | 8 | TS | 1 | EXPSTDTC | Experimental Start Date | 2008-01-01 | 9 | TS | 1 | EXPENDTC | Experimental End Date | 2008-03-07 | 10 | TS | 1 | TRMSAC | Time to Terminal Sacrifice | P42D | 11 | TS | 1 | STSTDTC | Study Start Date | 2007-12-30 | 12 | TS | 1 | DOSDUR | Dosing Duration | P42D | 13 | TS | 1 | STITLE | Study Title | Example of a Crossover study in the Rat with 3 dose levels and 3 dosing periods | 14 | TS | 1 | SNDIGVER | SEND Implementation Guide Version | SEND IMPLEMENTATION GUIDE VERSION 3.2 | 15 | TS | 1 | SNDCTVER | SEND Controlled Terminology Version | SEND Terminology 2021-03-26 | 16 | TS | 1 | STCAT | Study Category | TOX | 17 | TS | 1 | SSPONSOR | Sponsor Organization | Example Sponsor Inc. | 18 | TS | 1 | SPREFID | Sponsor's Study Reference ID | NOT APPLICABLE | 19 | TS | 1 | 1 | TSTFNAM | Test Facility Name | Example Tox Lab Name | 20 | TS | 1 | 1 | TSTFLOC | Test Facility Location | 10 Somewhere Street, Montgomery, AL 10000 | 21 | TS | 1 | 1 | TFCNTRY | Test Facility Country | USA | 22 | TS | 1 | AGETXT | Age Text | 6-8 | 23 | TS | 1 | AGEU | Age Unit | WEEKS | 24 | TS | 1 | 1 | STDIR | Study Director | Dr. R. Smith | 25 | TS | 1 | TRT | Investigational Therapy or Treatment | Drug A | 26 | TS | 1 | 2 | TRTV | Treatment Vehicle | Saline | 27 | TS | 1 | 2 | TRTVDESC | Treatment Vehicle Structured Description | 100.46 %(w/v) ISOTONIC SODIUM CHLORIDE SOLUTION {UNII VR5Y7PDT5W} | 28 | TS | 1 | GLPFL | GLP Flag | Y | 29 | TS | 1 | TRTCAS | Primary Treatment CAS Registry Number | TEMPORARILY UNAVAILABLE | | Expand |
---|
|
Expand |
---|
|
Row | STUDYID | ASSAYID | DOMAIN | ARMCD | ARM | TAETORD | ETCD | ELEMENT |
---|
1 | TA | ARM01-Prod1 | Cigarette Smoke Condensate, 10 ug/mL | 1 | TREATMT | Treatment | 9 | 9 | SLS-110 | 1 | Expand |
---|
title | te.xpt (trial elements) |
---|
|
Row | STUDYID | ASSAYID | DOMAIN | ETCD | ELEMENT |
---|
TE | TREATMT | Treatment | Expand |
---|
|
Expand |
---|
|
Red font (CT is coming!, POSITIVE CONTROL, VEHICLE CONTROL, etc.)
ARMCD. TREATMENT (element). SETCD
ARM01 TREATMT. CS-01. (Cigarette Smoke 10 ug/mL)
ARM01
TA.XPT
TRIAL ARMS
Row | STUDYID | ASSAYID | DOMAIN | ARMCD | ARM | TAETORD | ETCD | ELEMENT |
---|
1 | TA | ARM01-Prod1 | Cigarette Smoke Condensate, 10 ug/mL | 1 | TREATMT | Treatment | 2 | TA | ARM02-Prod1 | Cigarette Smoke Condensate, 50 ug/mL | 1 | TREATMT | Treatment | 3 | TA | ARM03-Prod1 | Cigarette Smoke Condensate, 75 ug/mL | 1 | TREATMT | Treatment | 4 | TA | 4 | 1 | 5 | TA | 5 | 1 | 6 | TA | 6 | 1 | 7 | 7 | 1 | 8 | 8 | 1 | 9 | 9 | SLS-110 | 1 | 10 | ARM10 | SLS-200 | 1 | TE.XPT
TRIAL ELEMENTS
Row | STUDYID | ASSAYID | DOMAIN | ETCD | ELEMENT |
---|
TE | TREATMT | Treatment | tx.spt
TRIAL SET
example: Each plate has a separate product
Product, Smoking Regime (e.g. Traditional combustible, ENDS), Smoke Fraction, etc.
https://www.itis.gov/servlet/SingleRpt/SingleRpt?search_topic=TSN&search_value=969610#null
Row | STUDYID | ASSAYID | DOMAIN | SETCD | SET | TXSEQ | TXPARMCD | TXPARM | TXVAL |
---|
1 | CS-10 | Cigarette Smoke Condensate, 10 ug/mL | METACT | Metabolic Activation | +S9 | 2 | CS-10 | Cigarette Smoke Condensate, 10 ug/mL | METACT | Metabolic Activation | -S9 | TX | CS-10 | Cigarette Smoke Condensate, 10 ug/mL | ARMCD | Arm Code | CS-10 | TX | CS-10 | Cigarette Smoke Condensate, 10 ug/mL | SPECIES | Species | Salmonella enterica | TX | CS-10 | Cigarette Smoke Condensate, 10 ug/mL | STRAIN | Strain/Substrain | Salmonella enterica enterica | TX | CS-10 | Cigarette Smoke Condensate, 10 ug/mL | PRODUCT | Product | product A | TX | CS-10 | Cigarette Smoke Condensate, 10 ug/mL | REGIME | Smoking Regime | Traditional combustible | TX | CS-20 | Cigarette Smoke Condensate, 50 ug/mL | ARMCD | Arm Code | CS-20 | TX | CS-20 | Cigarette Smoke Condensate, 50 ug/mL | PRODUCT | Product | product A | ... | TX | LSL-200 | sodium lauryl sulphate (SLS) positive control, 200 ug/mL | TRTDOS | Dose Level | 100 | TX | LSL-200 | sodium lauryl sulphate (SLS) positive control, 200 ug/mL | TCNTRL | Control Type | POSITIVE CONTROL | TX | LSL-200 | sodium lauryl sulphate (SLS) positive control, 200 ug/mL | CNTLAG | Control Agent | SODIUM LAURYL SULPHATE | TX | LSL-200 | sodium lauryl sulphate (SLS) positive control, 200 ug/mL | CNTLAGAMT | Control Agent amount (levels) | 110 | LSL-200 | sodium lauryl sulphate (SLS) positive control, 200 ug/mL | CNTLAGUNIT | Control Agent Unit | ug/mL | Expand |
---|
|
Row | STUDYID | DOMAIN | ENID (Entity ID) | ST vs. LT | Activation (+S9, -S9) | RUNID (Run-Port Number) | SMPID (Sample ID) | SMKFID (Smoke Fraction) | REPLCTID (Replicate Number) | PLATEID (Plate ID) | COLID (Column number) | ROWID (Row number) | SETCD (Set Code, TX) | RFSTDTC | RFENDTC | RFXSTDTC | RFXENDTC | RFCSTDTC | RFCENDTC | ARMCD | 1 | MA99999 | EI | 1 | 1-1 | 030001 | A | 1 | 1 | 1 | A | CS-10 | 2008-04-01T06:00 | | 2008-04-02T14:00 | 2008-04-02T14:04 | 2008-04-01T06:00 | 2008-04-01T06:00 | 3 | 2 | MA99999 | EI | 2 | 1-1 | 030001 | A | 1 | 1 | 1 | B | CS-10 | 2008-04-01T06:00 | 2008-04-21T14:00 | 2008-04-02T20:00 | 2008-04-02T20:04 | 2008-04-01T06:00 | 2008-04-01T06:00 | 3 |
Expand |
---|
|
Image Removed |
MTACTIND | Metabolic Activating Agent Name | +S9 | 2 | 123 | TX | A1 | ST+S9_C0 | 2 | METACTFL | Presence of Metabolic Activation Flag | Y | 3 | 123 | TX | A1 | ST+S9_C0 | 3 | IVTDMIN | In vitro Treatment Duration Minimum | 3 | 4 | 123 | TX | A1 | ST+S9_C0 | 4 | IVTDTRG | In vitro Treatment Duration Target | 3.5 | 5 | 123 | TX | A1 | ST+S9_C0 | 5 | IVTDMAX | In vitro Treatment Duration Maximum | 4 | 6 | 123 | TX | A1 | ST+S9_C0 | 6 | IVTDU | In vitro Treatment Duration Unit | HOURS | 7 | 123 | TX | A1 | ST+S9_C0 | 7 | RCVDMIN | Recovery Duration Minimum | 23.5 | 8 | 123 | TX | A1 | ST+S9_C0 | 8 | RCVDTRG | Recovery Duration Target | 24 | 9 | 123 | TX | A1 | ST+S9_C0 | 9 | RCVDMAX | Recovery Duration Maximum | 24.5 | 10 | 123 | TX | A1 | ST+S9_C0 | 10 | RCVDU | Recovery Duration Unit | HOURS | 11 | 123 | TX | A1 | ST+S9_C0 | 11 | INCBTMP | Incubation Temperature | 37 | 12 | 123 | TX | A1 | ST+S9_C0 | 12 | INCBTMPU | Incubation Temperature Unit | C | 13 | 123 | TX | A1 | ST+S9_C0 | 13 | ATMRHP | Atmospheric Relative Humidity Percent | 50 | 14 | 123 | TX | A1 | ST+S9_C0 | 14 | ATMCO2P | Atmospheric CO2 Percent | 5 | 15 | 123 | TX | A1 | ST+S9_C0 | 15 | SPTOBID | Applicant-defined tobacco identifier | CIG01a | 16 | 123 | TX | A1 | ST+S9_C0 | 16 | EXPTYP | | Submerged | 17 | 123 | TX | A1 | ST+S9_C0 | 17 | SAMTYP | Sample Type | Total Particulate Matter in DMSO | 18 | 123 | TX | A1 | ST+S9_CO | 18 | ITVNAM | Intervention Article Name | Tobacco ProdA | 19 | 123 | TX | A1 | ST+S9_C0 | 19 | ITVTYPE | Intervention Article Type | Negative Control | 20 | 123 | TX | A1 | ST+S9_C0 | 20 | ITVCONC | Intervention Article Concentration | 0 | 21 | 123 | TX | A1 | ST+S9_C0 | 21 | ITVCONCU | Intervention Article Concentration Unit | ug/ml | 22 | 123 | TX | A1 | ST+S9_C0 | 22 | SPDEVID | Applicant-defined device identifier | PUFFMASTER3K | 23 | 123 | TX | A1 | ST+S9_C0 | 23 | SMKRGM | Smoking Regimen | MEDIUM INTENSITY REGIMEN | 24 | 123 | TX | A2 | ST+S9_C1250 | 24 | MTACTIND | Metabolic Activating Agent Name | +S9 | 25 | 123 | TX | A2 | ST+S9_C1250 | 25 | METACTFL | Presence of Metabolic Activation Flag | Y | 26 | 123 | TX | A2 | ST+S9_C1250 | 26 | IVTDMIN | In vitro Treatment Duration Minimum | 3 | 27 | 123 | TX | A2 | ST+S9_C1250 | 27 | IVTDTRG | In vitro Treatment Duration Target | 3.5 | 28 | 123 | TX | A2 | ST+S9_C1250 | 28 | IVTDMAX | In vitro Treatment Duration Maximum | 4 | 29 | 123 | TX | A2 | ST+S9_C1250 | 29 | IVTDU | In vitro Treatment Duration Unit | HOURS | 30 | 123 | TX | A2 | ST+S9_C1250 | 30 | RCVDMIN | Recovery Duration Minimum | 23.5 | 31 | 123 | TX | A2 | ST+S9_C1250 | 31 | RCVDTRG | Recovery Duration Target | 24 | 32 | 123 | TX | A2 | ST+S9_C1250 | 32 | RCVDMAX | Recovery Duration Maximum | 24.5 | 33 | 123 | TX | A2 | ST+S9_C1250 | 33 | RCVDU | Recovery Duration Unit | HOURS | 34 | 123 | TX | A2 | ST+S9_C1250 | 34 | INCBTMP | Incubation Temperature | 37 | 35 | 123 | TX | A2 | ST+S9_C1250 | 35 | INCBTMPU | Incubation Temperature Unit | C | 36 | 123 | TX | A2 | ST+S9_C1250 | 36 | ATMRHP | Atmospheric Relative Humidity Percent | 50 | 37 | 123 | TX | A2 | ST+S9_C1250 | 37 | ATMCO2P | Atmospheric CO2 Percent | 5 | 38 | 123 | TX | A2 | ST+S9_C1250 | 38 | SPTOBID | Applicant-defined tobacco identifier | CIG01a | 39 | 123 | TX | A2 | ST+S9_C1250 | 39 | EXPTYP | | Submerged | 40 | 123 | TX | A2 | ST+S9_C1250 | 40 | SAMTYP | Sample Type | Total Particulate Matter in DMSO | 41 | 123 | TX | A2 | ST+S9_C1250 | 41 | ITVNAM | Intervention Article Name | Tobacco ProdA | 42 | 123 | TX | A2 | ST+S9_C1250 | 42 | ITVTYPE | Intervention Article Type | Product | 43 | 123 | TX | A2 | ST+S9_C1250 | 43 | ITVCONC | Intervention Article Concentration | 1250 | 44 | 123 | TX | A2 | ST+S9_C1250 | 44 | ITVCONCU | Intervention Article Concentration Unit | ug/ml | 45 | 123 | TX | A2 | ST+S9_C1250 | 45 | SPDEVID | Applicant-defined Device Identifier | PUFFMASTER2023 | 46 | 123 | TX | A2 | ST+S9_C1250 | 46 | SMKRGM | Smoking Regimen | HIGH INTENSITY REGIMEN |
|
|
Dataset wrap |
---|
|
Rowcaps |
---|
Row 1: | Shows the value of REFID=C0. This REFID refers to the trial set with a SETCD of "A1", as defined in the TX dataset. LEVEL=1 and LVLDESC="EXPERIMENTAL UNIT/TRIAL SET" indicates this identifier is referring to both the experimental unit and the unit to which the treatment is applied, and to the entire trial set. | Rows 2-5: | Show the values of 4 observational units (C0_Count1 through C0_Count4) that are within the parent experimental unit, REFID=C0. In this example assay, these observational units are also all within the same trial set, as defined in the TX dataset. | Row 6: | Shows the value of REFID=C1250. This REFID refers to the trial set with a SETCD of "A2", as defined in the TX dataset. LEVEL=1 and LVLDESC="EXPERIMENTAL UNIT/TRIAL SET" indicates this identifier is referring to both the experimental unit and the unit to which the treatment is applied, and to the entire trial set. | Rows 7-10: | Show the values of 4 observational units (C1250_Count1 through C1250_Count4) that are within the parent experimental unit, REFID=C1250. In this example assay, these observational units are also all within the same trial set, as defined in the TX dataset. |
|
Dataset2 |
---|
| Row | STUDYID | SETCD | REFID | PARENT | LEVEL | LVLDESC |
---|
1 | 123 | | C0 |
| 1 | EXPERIMENTAL UNIT/TRIAL SET | 2 | 123 | A1 | C0-Count1 | C0 | 2 | OBSERVATIONAL UNIT | 3 | 123 | A1 | C0-Count2 | C0 | 2 | OBSERVATIONAL UNIT | 4 | 123 | A1 | C0-Count3 | C0 | 2 | OBSERVATIONAL UNIT | 5 | 123 | A1 | C0-Count4 | C0 | 2 | OBSERVATIONAL UNIT | 6 | 123 | A2 | C1250 |
| 1 | EXPERIMENTAL UNIT/TRIAL SET | 7 | 123 | A2 | C1250-Count1 | C1250 | 2 | OBSERVATIONAL UNIT | 8 | 123 | A2 | C1250-Count2 | C1250 | 2 | OBSERVATIONAL UNIT | 9 | 123 | A2 | C1250-Count3 | C1250 | 2 | OBSERVATIONAL UNIT | 10 | 123 | A2 | C1250-Count4 | C1250 | 2 | OBSERVATIONAL UNIT |
|
|
Dataset wrap |
---|
|
Rowcaps |
---|
Rows 1-3, 8: | Show percentage result values that apply to GTREFID=C0. REFID=C0, as shown in the RELREF dataset, relates this data to the trial set in the first row of table 1 in the sample report table for study 123. | Rows 4-7: | Show the 4 micronucleated cell counts for the observational units with GTREFID from C0-Count1 through C0-Count4, for which their relationship to test conditions (in tx.xpt) and experimental units (in relref.xpt) are shown in the RELREF dataset. | Rows 9-11, 16: | Show percentage result values that apply to GTREFID=C1250. REFID=C1250, as shown in the RELREF dataset, relates this data to the trial set in the second row of table 1 in the sample report table for study 123. | Rows 12-15: | Show the 4 micronucleated cell counts for the observational units with GTREFID from C1250-Count1 through C1250-Count4, for which their relationship to test conditions (in tx.xpt) and experimental units (in relref.xpt) are shown in the RELREF dataset. |
|
Dataset2 |
---|
Row | STUDYID | DOMAIN | GTSEQ | GTREFID | GTTESTCD | GTTEST | GTCELLEV | GTORRES | GTORRESU | GTCOLSRT | GTSTRESC | GTSTRESN | GTSTRESU | GTDTC |
---|
1 | 123 | GT | 1 | C0 | | Relative Increase in Cell Count | 154 | 0 | % |
| 0 | 0 | % | 2022-05-25 | 2 | 123 | GT | 2 | C0 | RCC | Relative Cell Count | 154 | 0 | % |
| 0 | 0 | % | 2022-05-25 | 3 | 123 | GT | 3 | C0 | RPD | Relative Population Doubling | 154 | 0 | % |
| 0 | 0 | % | 2022-05-25 | 4 | 123 | GT | 4 | C0-Count1 | MNCE | Micronucleated Cells | 2205 | 15 | |
| 15 | 15 |
| 2022-05-25 | 5 | 123 | GT | 5 | C0-Count2 | MNCE | Micronucleated Cells | 2474 | 13 |
|
| 13 | 13 |
| 2022-05-25 | 6 | 123 | GT | 6 | C0-Count3 | MNCE | Micronucleated Cells | 2758 | 17 |
|
| 17 | 17 |
| 2022-05-25 | 7 | 123 | GT | 7 | C0-Count4 | MNCE | Micronucleated Cells | 2669 | 12 |
|
| 12 | 12 |
| 2022-05-25 | 8 | 123 | GT | 8 | C0 | MNCECE | Micronucleated Cells/Total Cells |
| 0.57 | % |
| 0.57 | 0.57 | % | 2022-05-25 | 9 | 123 | GT | 1 | C1250 | RICC | Relative Increase in Cell Count | 134 | 15.7 | % |
| 15.7 | 15.7 | % | 2022-05-25 | 10 | 123 | GT | 2 | C1250 | RCC | Relative Cell Count | 134 | 13.0 | % |
| 13.0 | 13.0 | % | 2022-05-25 | 11 | 123 | GT | 3 | C1250 | RPD | Relative Population Doubling | 134 | 7.9 | % |
| 7.9 | 7.9 | % | 2022-05-25 | 12 | 123 | GT | 4 | C1250-Count1 | MNCE | Micronucleated Cells | 3266 | 20 |
|
| 20 | 20 |
| 2022-05-25 | 13 | 123 | GT | 5 | C1250-Count2 | MNCE | Micronucleated Cells | 2190 | 17 |
|
| 17 | 17 |
| 2022-05-25 | 14 | 123 | GT | 6 | C1250-Count3 | MNCE | Micronucleated Cells | 2758 | 13 |
|
| 13 | 13 |
| 2022-05-25 | 15 | 123 | GT | 7 | C1250-Count4 | MNCE | Micronucleated Cells | 2714 | 21 |
|
| 21 | 21 |
| 2022-05-25 | 16 | 123 | GT | 8 | C1250 | MNCECE | Micronucleated Cells/Total Cells |
| 0.66 | % |
| 0.66 | 0.66 | % | 2022-05-25 |
|
|
Expand |
---|
title | Notes for creating GT domain |
---|
|
- Entity ID links to EI domain (usubjid)
- TEST: After ST exposure to increasing concentrations of test article in the presence of S9 mix
Expand |
---|
title | gt.xpt (similar to LB) |
---|
|
|
Row | STUDYID | DOMAIN | ENID (Entity ID) | GTSEQ | GTTESTCD | GTTEST | GTORRES | GTORRESU | GTSTRESC | GTSTRESN | GTSTRESU | GTSPEC??? | GTMETHOD | GTDTC | GTDY | GTNOMDY | GTELTM | GTTPTREF |
---|
1 | ST487-12 | GT | 1 | MNT | In vitro Micronucleus Assay | ug/mL | ug/mL | 2 | ST487-12 | GT | 2 | MNT | In vitro Micronucleus Assay | ug/mL | ug/mL | 3 | ST487-12 | GT | 3 | MNT | In vitro Micronucleus Assay | ug/mL | ug/mL | 4 | ST487-12 | GT | 4 | MNT | In vitro Micronucleus Assay | ug/mL | ug/mL | 5 | ST487-12 | GT | 5 | MNT | In vitro Micronucleus Assay | ug/mL | ug/mL | 6 | ST487-12 | GT | 6 | MNT | In vitro Micronucleus Assay | ug/mL | ug/mL | 7 | ST487-12 | GT | 7 | MNT | In vitro Micronucleus Assay | ug/mL | ug/mL | 8 | ST487-12 | GT | 8 | MNT | In vitro Micronucleus Assay | ug/mL | ug/mL | 9 | ST487-12 | GT | 9 | MNT | In vitro Micronucleus Assay | ug/mL | ug/mL